Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ CISD1 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$383.00each

Catalog Number: LS-B15585-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: CISD1 antibody LS-B15585 is an unconjugated rabbit polyclonal antibody to CISD1 from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CDGSH iron sulfur domain 1 | C10orf70 | CISD1 | MDS029 | ZCD1 | MitoNEET
Recommended Dilution: IHC-P: 1:200
Recommended Dilution: WB: 1:1000 - 1:2000
UniProt Number: Q9NZ45
NCBI GenBank: NM_018464 | NP_060934.1
SwissProt: Q9NZ45

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1). LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)