Calgizzarin / S100A11 Antibody
Catalog Number: LS-C660586-100
100 µg / $359.00
Antibody: Mouse Monoclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Western Blot
Reactivity: Human
Format: Liquid
Immunohistochemistry of paraffin-embedded human kidney cancer using S100A11 antibody at dilution of 1:200 (400x lens).
IHC-plus™ Calgizzarin / S100A11 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$383.00each
Catalog Number: LS-B14896-50
Catalog Number: LS-B14896
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- S100A11 antibody LS-B14896 is an unconjugated rabbit polyclonal antibody to S100A11 (Calgizzarin) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
- Application
- IF, IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Calgizzarin | MLN 70 | MLN70 | S100A11 | Protein S100-A11 | Protein S100-C | S100C
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: IHC-P
- 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P31949
- NCBI GenBank
- NM_005620 | NP_005611.1
- SwissProt
- P31949
Target
- Target
- Calgizzarin / S100A11
- Antigen Species
- Human
- Specificity
- Human Calgizzarin / S100A11
- Epitope
- Human Calgizzarin / S100A11
- Gene Name
- S100A11
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
