Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ ACVR1C / ALK7 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$470.00each

Catalog Number: LS-B13293-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ALK7 antibody LS-B13293 is an unconjugated rabbit polyclonal antibody to ALK7 (ACVR1C) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Activin receptor-like kinase 7 | ACTR-IC | Activin receptor type IC | ACVRLK7 | Activin receptor type-1C | ALK7 | Activin A receptor, type IC | ACVR1C | ALK-7
Recommended Dilution: IHC: 1:100 - 1:200
Recommended Dilution: IHC-P: 1:67
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q8NER5
NCBI GenBank: NM_145259 | NP_660302.2
SwissProt: Q8NER5

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2). LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)