IGFBP5 antibody Western blot. All lanes: Anti IGFBP5 at 0.5 ug/ml. Lane 1: U20S Whole Cell Lysate at 40 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 23 kD. Observed band size: 23 kD.

IGFBP5 Antibody (aa76-114)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Enzyme-Linked Immunosorbent Assay, Western Blot
Reactivity:	Human, Rabbit
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407923-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: IGFBP5 antibody LS-C407923 is an unconjugated rabbit polyclonal antibody to IGFBP5 (aa76-114) from human. It is reactive with human and rabbit. Validated for ELISA and WB.
Application: ELISA, WB
Reactivity: Hu, Rb
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: IBP-5 | IGFBP-5 | IBP5 | IGF-binding protein 5 | IGFBP5
Recommended Dilution: ELISA: 0.1 - 0.5 ug/ml
UniProt Number: P24593
NCBI GenBank: NM_000599 | NP_000590.1
SwissProt: P24593

Target

Target: Human IGFBP5
Antigen Species: Human
Epitope: Osteosarcoma, and at lower levels in liver, kidney and brain.
Gene Name: IGFBP5

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human IGFBP5 (76-114 aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER), different from the related mouse and rat sequences by two amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl