Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
IGFBP3 Antibody (aa214-252)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407922-100
Catalog Number: LS-C407922
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IGFBP3 antibody LS-C407922 is an unconjugated rabbit polyclonal antibody to IGFBP3 (aa214-252) from human. It is reactive with human and rat. Validated for ELISA, IHC and WB. Cited in 1 publication.
- Application
- ELISA, IHC, IHC-P, WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Binding protein 29 | Binding protein 53 | BP-53 | IGF-binding protein 3 | IGFBP-3 | IBP-3 | IBP3 | IGFBP3
- Recommended Dilution: ELISA
- 0.1 - 0.5 ug/ml
- UniProt Number
- P17936
- NCBI GenBank
- NM_000598 | NP_000589.2
- SwissProt
- P17936
Target
- Target
- Human IGFBP3
- Antigen Species
- Human
- Epitope
- Expressed by most tissues. Present in plasma.
- Gene Name
- IGFBP3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human IGFBP-3 (214-252 aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
EZH1 and EZH2 promote skeletal growth by repressing inhibitors of chondrocyte proliferation and hypertrophy. Lui JC, Garrison P, Nguyen Q, Ad M, Keembiyehetty C, Chen W, Jee YH, Landman E, Nilsson O, Barnes KM, Baron J. Nature communications. 2016;7:13685. PubMed: 27897169
