IGFBP2 antibody Western blot. All lanes: Anti IGFBP2 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Predicted band size: 35 kD. Observed band size: 35 kD.
IGFBP2 / IGF-BP53 Antibody (aa228-257)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Chicken, Horse, Human, Mammal (Other), Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407818-100
Catalog Number: LS-C407818
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IGF-BP53 antibody LS-C407818 is an unconjugated rabbit polyclonal antibody to IGF-BP53 (IGFBP2) (aa228-257) from human. It is reactive with human, rat, bat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Ck, Hr, Hu, Mml, Por, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BP2 | IGFBP-2 | IGF-binding protein 2 | IBP-2 | IGFBP2 | IBP2 | IGF-BP53
- UniProt Number
- P18065
- NCBI GenBank
- NM_000597 | NP_000588.2
- SwissProt
- P18065
Target
- Target
- Human IGFBP2 / IGF-BP53
- Antigen Species
- Human
- Gene Name
- IGFBP2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human IGFBP2 (228-257 aa QQELDQVLERISTMRLPDERGPLEHLYSLH), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl