
FFPE human lung carcinoma.
IDO1 / IDO Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490278-100
Catalog Number: LS-C490278
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IDO antibody LS-C490278 is an unconjugated rabbit polyclonal antibody to human IDO (IDO1). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- IDO | Indole 2,3-dioxygenase | Indolamine 2,3 dioxygenase | IDO-1 | IDO1 | INDO | Indoleamine 2,3-dioxygenase | Indoleamine 2,3-dioxygenase 1
- UniProt Number
- P14902
- NCBI GenBank
- AAA36081.1 | NM_002164
- SwissProt
- P14902
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human IDO1 / IDO
- Antigen Species
- Human
- Gene Name
- IDO1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH of human IDO1 were used as the immunogen for the IDO1 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
