Western blot testing of 1) rat brain, 2) mouse brain, 3) human HeLa and 4) human U-2 OS lysate with IBSP antibody at 0.5ug/ml. Expected molecular weight: 35~70 kDa depending on glycosylation level.
IBSP / Bone Sialoprotein Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782042-100
Catalog Number: LS-C782042
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Bone Sialoprotein antibody LS-C782042 is an unconjugated rabbit polyclonal antibody to Bone Sialoprotein (IBSP) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Bone Sialoprotein | Bone sialoprotein II | BSP | BSP II | Cell-binding sialoprotein | BNSP | Bone Sialprotein II | IBSP | Integrin-binding sialoprotein | Bone sialoprotein 2 | BSP-II | SP-II
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P21815
- NCBI GenBank
- NM_004967 | NP_004958.2
- SwissProt
- P21815
Target
- Target
- Human IBSP / Bone Sialoprotein
- Antigen Species
- Human
- Gene Name
- IBSP
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ were used as the immunogen for the IBSP antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS