IAPP / Amylin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin |
| Reactivity: | Human |
| Format: | Lyophilized |
$584.00each
Catalog Number: LS-C190476-50
Catalog Number: LS-C190476
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Amylin antibody LS-C190476 is an unconjugated rabbit polyclonal antibody to human Amylin (IAPP). Validated for IHC.
- Application
- IHC, IHC-P
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Diabetes-associated peptide | Islet amyloid polypeptide | AMYLIN | IAP | IAPP | Insulinoma amyloid peptide
- UniProt Number
- P10997
- NCBI GenBank
- NM_000415|NP_000406.1
- SwissProt
- P10997
Target
- Target
- Human IAPP / Amylin
- Antigen Species
- Human
- Epitope
- Human Amylin.
- Gene Name
- IAPP
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic peptide corresponding to human Amylin (KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized
- Volume
- 50 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.