Western blot testing of 1) human MCF7, 2) rat heart and 3) mouse heart lysate with HTRA1 antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.

HTRA1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782094-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: HTRA1 antibody LS-C782094 is an unconjugated rabbit polyclonal antibody to HTRA1 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ARMD7 | HtrA serine peptidase 1 | HTRA1 | IGFBP5-protease | HtrA | ORF480 | Serine protease 11 | CARASIL | L56 | PRSS11 | Serine protease HTRA1
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q92743
NCBI GenBank: NM_002775 | NP_002766.1
SwissProt: Q92743

Immunogen: Amino acids QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD were used as the immunogen for the HTRA1 antibody.

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS