Western blot analysis of extracts of various cell lines, using HTR2B Antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
HTR2B / 5-HT2B Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C746820-20
Catalog Number: LS-C746820
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- 5-HT2B Receptor antibody LS-C746820 is an unconjugated rabbit polyclonal antibody to 5-HT2B Receptor (HTR2B) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 5-HT 2B receptor | 5HT2B Receptor | 5-HT(2B) | 5-HT-2B | 5-HT2b receptor | 5-HT2B | HTR2B | Serotonin 2b receptor | Serotonin 5-HT-2b receptor | Serotonin receptor 2B
- Recommended Dilution: WB
- 1:200 - 1:1000
- UniProt Number
- P41595
- NCBI GenBank
- NM_000867 | NP_000858.3
- SwissProt
- P41595
Target
- Target
- Human HTR2B / 5-HT2B Receptor
- Antigen Species
- Human
- Gene Name
- HTR2B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 233-330 of human HTR2B (NP_000858.3). MIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVF
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 1.39 mg/mL
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS