Western blot analysis of extracts of various cell lines, using HTR2B antibody.
HTR2B / 5-HT2B Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334205-20
Catalog Number: LS-C334205
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- 5-HT2B Receptor antibody LS-C334205 is an unconjugated rabbit polyclonal antibody to 5-HT2B Receptor (HTR2B) from human. It is reactive with human, mouse and rat. Validated for IF and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 5-HT 2B receptor | 5HT2B Receptor | 5-HT(2B) | 5-HT-2B | 5-HT2b receptor | 5-HT2B | HTR2B | Serotonin 2b receptor | Serotonin 5-HT-2b receptor | Serotonin receptor 2B
- Recommended Dilution: IF/ICC
- 1:10 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P41595
- NCBI GenBank
- NM_000867 | NP_000858.3
- SwissProt
- P41595
Target
- Target
- Human HTR2B / 5-HT2B Receptor
- Antigen Species
- Human
- Epitope
- Human HTR1B / 5-HT2B Receptor
- Gene Name
- HTR2B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 382-481 of human HTR2B (NP_000858.3). LFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS