5HT2A Receptor antibody Western blot. All lanes: Anti 5HT2A Receptor at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: U87 Whole Cell Lysate at 40 ug. Predicted band size: 53 kD. Observed band size: 53 kD.
HTR2A / 5-HT2A Receptor Antibody (aa400-431)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Dog, Guinea Pig, Human, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407811-100
Catalog Number: LS-C407811
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- 5-HT2A Receptor antibody LS-C407811 is an unconjugated rabbit polyclonal antibody to 5-HT2A Receptor (HTR2A) (aa400-431) from human. It is reactive with human, rat, dog and other species. Validated for WB.
- Application
- WB
- Reactivity
- Can, GP, Hu, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 5-HT2A | 5-HT-2A | 5-HT2a receptor | 5HT2A Receptor | 5-HT-2 | 5-HT2A/2C | 5-HT2A/2C receptor | 5-HT2 receptor | HTR2 | HTR2A | Serotonin 5-HT-2A receptor | Serotonin receptor 2A | Serotonin 2a receptor
- UniProt Number
- P28223
- NCBI GenBank
- NM_000621 | NP_000612.1
- SwissProt
- P28223
Target
- Target
- Human HTR2A / 5-HT2A Receptor
- Antigen Species
- Human
- Epitope
- Detected in brain cortex (at protein level). Detected in blood platelets. .
- Gene Name
- HTR2A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human 5HT2A Receptor (400-431 aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl