HSPD1 / HSP60 Antibody (Preservative Free)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Human |
| Format: | Lyophilized |
$247.00each
Catalog Number: LS-C149221-20
Catalog Number: LS-C149221
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HSP60 antibody LS-C149221 is an unconjugated rabbit polyclonal antibody to human HSP60 (HSPD1). Validated for ELISA.
- Application
- ELISA
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 60 kDa chaperonin | CPN60 | Heat shock protein 65 | Heat shock protein 60 | HSP-60 | HSPD1 | HSP60 | HuCHA60 | HLD4 | HSP65 | p60 lymphocyte protein | SPG13 | Chaperonin 60 | GROEL
- Recommended Dilution: ELISA
- 1:64000
- UniProt Number
- P10809
- NCBI GenBank
- NM_002156 | NP_002147.2
- SwissProt
- P10809
Target
- Target
- Human HSPD1 / HSP60
- Antigen Species
- Human
- Epitope
- The antibody can specifically bind to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. The specificity for binding to recombinant protein, cellular protein and native antigen is not defined. Cross reactivity with mouse and rat HSP60 has not yet been tested.
- Gene Name
- HSPD1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Synthetic peptide derived from human HSP60. Immunogen Sequence: CAIATGGAVFGEEGLTLNLEDVQPHDLGK.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, No preservatives added
- Preservative
- No
- Purification Method
- Protein A/G Affinity
Storage & Handling
- Storage Conditions
- Short term: Store at 4°C for up to 1 month. Long term: Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS