Grp75 antibody Western blot. All lanes: Anti Grp75 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Rat Testis Tissue Lysate at 50 ug. Lane 4: Mouse Liver Tissue Lysate at 50 ug. Lane 5: Mouse Thymus Tissue Lysate at 50 ug. Lane 6: Mouse Testis Tissue Lysate at 50 ug. Lane 7: HELA Whole Cell Lysate at 40 ug. Lane 8: MCF-7 Whole Cell Lysate at 40 ug. Lane 9: SW620 Whole Cell Lysate at 40 ug. Lane 10: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 74 kD. Observed band size: 74 kD.
HSPA9 / Mortalin / GRP75 Antibody (aa646-679)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Hamster, Human, Mouse, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407854-100
Catalog Number: LS-C407854
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GRP75 antibody LS-C407854 is an unconjugated rabbit polyclonal antibody to GRP75 (HSPA9 / Mortalin) (aa646-679) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Ham, Hu, Ms, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Heat shock 70 kDa protein 9 | GRP-75 | Heat shock 70kD protein 9B | GRP75 | Mortalin-2 | Mortalin, perinuclear | Mot-2 | MOT2 | HSPA9 | Peptide-binding protein 74 | MOT | MTHSP75 | p66-mortalin | PBP74 | CSA | HSPA9B | Mortalin
- UniProt Number
- P38646
- NCBI GenBank
- NM_004134 | NP_004125.3
- SwissProt
- P38646
Target
- Target
- Human HSPA9 / Mortalin / GRP75
- Antigen Species
- Human
- Gene Name
- HSPA9
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Grp75 (646-679 aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl