IHC analysis of HSPA2 using anti-HSPA2 antibody. HSPA2 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-HSPA2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.

HSPA2 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Mouse Monoclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$480.00each

Catalog Number: LS-C756667-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: HSPA2 antibody LS-C756667 is an unconjugated mouse monoclonal antibody to HSPA2 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Monoclonal Antibodies
Alternative Names: Heat shock 70kD protein 2 | HSPA2 | HSP70-2 | HSP70-3 | Heat shock 70 kDa protein 2 | Heat shock 70kDa protein 2
Recommended Dilution: IHC-P: 0.5 - 1 µg/ml
Recommended Dilution: WB: 0.1 - 0.5 µg/ml
UniProt Number: P54652
NCBI GenBank: NM_021979 | NP_068814.2
SwissProt: P54652

Target

Target: Human HSPA2
Antigen Species: Human
Epitope: No cross reactivity with other proteins.
Gene Name: HSPA2

Antibody

Host Species: Mouse
Clonality: Monoclonal
Isotype: IgG1
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human HSPA2 (564-598 aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Recommended Storage Buffer: NaCl