Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
HSPA2 Antibody (DY550)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Flow Cytometry |
| Reactivity: | Human |
| Format: | Liquid |
$583.00each
Catalog Number: LS-C756639-228
Catalog Number: LS-C756639
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HSPA2 antibody LS-C756639 is a DY550-conjugated mouse monoclonal antibody to human HSPA2. Validated for Flow.
- Application
- FC
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- Heat shock 70kD protein 2 | HSPA2 | HSP70-2 | HSP70-3 | Heat shock 70 kDa protein 2 | Heat shock 70kDa protein 2
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- UniProt Number
- P54652
- NCBI GenBank
- NM_021979 | NP_068814.2
- SwissProt
- P54652
Target
- Target
- Human HSPA2
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- HSPA2
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Isotype
- IgG1
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human HSPA2 (564-598 aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- DyLight 550
- Format
- Liquid
- Formulation
- 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. Do not freeze. Protect from light.
- Recommended Storage Buffer
- NaCl
