Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
IHC analysis of Hsp70 using anti-Hsp70 antibody. Hsp70 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-Hsp70 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
HSPA1A Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Frozen, Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756640-100
Catalog Number: LS-C756640
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HSPA1A antibody LS-C756640 is an unconjugated mouse monoclonal antibody to HSPA1A from human. It is reactive with human, mouse and rat. Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC-F, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- Heat shock 70kDa protein 1A | Heat shock 70 kDa protein 1/2 | Heat shock 70kD protein 1A | HSP70-1/HSP70-2 | HSPA1 | HSP70-1A | Heat shock 70 kd protein 1 | Heat shock-induced protein | Iroquois homeobox protein 4 | HSP70-1 | Hsp70.1 | HSP70.1/HSP70.2 | HSP70I | HSP72 | HSPA1A
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: IF/ICC
- 0.5 - 1 µg/ml
- Recommended Dilution: IHC-F
- 0.5 - 1 µg/ml
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- NCBI GenBank
- NM_005345 | NP_005336.3
Target
- Target
- Human HSPA1A
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Isotype
- IgG1
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp70 (559-596 aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
