Hsp90 alpha antibody Western blot. All lanes: Anti Hsp90 alpha at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 3: Rat Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: JURKAT Whole Cell Lysate at 40 ug. Lane 6: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 90 kD. Observed band size: 90 kD.
HSP90AA1 / Hsp90 Alpha A1 Antibody (aa454-488)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Human, Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407847-100
Catalog Number: LS-C407847
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Hsp90 Alpha A1 antibody LS-C407847 is an unconjugated rabbit polyclonal antibody to Hsp90 Alpha A1 (HSP90AA1) (aa454-488) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Hu, Ms, Por, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EL52 | HSP86 | Hsp89 | HSP89A | HSPC1 | Heat shock 86 kDa | Hsp90 | HSP90A | HSP90AA1 | HSP90N | HSPCA | HSPCAL4 | HSPN | LAP2 | HSP 86 | HSPCAL1
- UniProt Number
- P07900
- NCBI GenBank
- NM_005348 | NP_005339.3
- SwissProt
- P07900
Target
- Target
- Human HSP90AA1 / Hsp90 Alpha A1
- Antigen Species
- Human
- Gene Name
- HSP90AA1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp90 alpha (454-488 aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl