Heparanase 1 antibody Western blot. All lanes: Anti Heparanase 1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Human Placenta Tissue Lysate at 50 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 61 kD. Observed band size: 61 kD.
HPSE / Heparanase Antibody (aa301-331)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407641-100
Catalog Number: LS-C407641
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Heparanase antibody LS-C407641 is an unconjugated rabbit polyclonal antibody to Heparanase (HPSE) (aa301-331) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Endo-glucoronidase | Heparanase-1 | Heparanase | HPA | HSE1 | HEP | HPA1 | HPSE | HPSE1 | HPR1
- UniProt Number
- Q9Y251
- NCBI GenBank
- NM_006665 | NP_006656.2
- SwissProt
- Q9Y251
Target
- Target
- Human HPSE / Heparanase
- Antigen Species
- Human
- Epitope
- Highly expressed in placenta and spleen and weakly expressed in lymph node, thymus, peripheral blood leukocytes, bone marrow, endothelial cells, fetal liver and tumor tissues. Also expressed in hair follicles, specifically in both Henle's and Huxley's layers of inner the root sheath (IRS) at anagen phase. .
- Gene Name
- HPSE
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331 aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl