Western blot analysis of extracts of various cell lines, using HOXC4 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

HOXC4 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C748875-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: HOXC4 antibody LS-C748875 is an unconjugated rabbit polyclonal antibody to HOXC4 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Homeobox protein Hox-3E | Homeo box C4 | HOXC4 | Homeo box 3E | Homeobox protein CP19 | Homeobox protein Hox-C4 | Cp19 | Homeobox C4 | HOX3 | HOX3E
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P09017
NCBI GenBank: NM_014620 | NP_055435.2
SwissProt: P09017

Target

Target: Human HOXC4
Antigen Species: Human
Gene Name: HOXC4

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human HOXC4 (NP_055435.2). PEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAAS
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)