Western blot analysis of extracts of mouse kidney, using HOXB9 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

HOXB9 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C496930-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: HOXB9 antibody LS-C496930 is an unconjugated rabbit polyclonal antibody to HOXB9 from human. It is reactive with mouse and rat. Validated for WB.
Application: WB
Reactivity: Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Homeobox B9 | HOX-2.5 | Homeo box 2E | Homeobox protein Hox-B9 | HOX2E | Homeobox protein Hox-2E | HOXB9 | Homeo box B9 | Homeobox protein Hox-2.5 | HOX2
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P17482
NCBI GenBank: NM_024017 | NP_076922.1
SwissProt: P17482

Target

Target: Human HOXB9
Antigen Species: Human
Gene Name: HOXB9

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human HOXB9 (NP_076922.1). MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHP
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)