Western blot - Anti-HnRNP A1 Picoband Antibody
HNRPA1 / HnRNP A1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662098-100
Catalog Number: LS-C662098
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HnRNP A1 antibody LS-C662098 is an unconjugated mouse monoclonal antibody to human HnRNP A1 (HNRPA1). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- HNRPA1L3 | HnRNP A1 | HnRNP A1-like 3 | HnRNP core protein A1 | HNRNPA1 | Helix-destabilizing protein | HNRPA1 | HnRNP core protein A1-like 3 | HnRNP-A1
- NCBI GenBank
- NM_002136 | NP_002127.1
Target
- Target
- Human HNRPA1 / HnRNP A1
- Antigen Species
- Human
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human HnRNP A1 (8-42 aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl