
HNF1B / HNF1 Beta Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490272-100
Catalog Number: LS-C490272
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HNF1 Beta antibody LS-C490272 is an unconjugated rabbit polyclonal antibody to HNF1 Beta (HNF1B) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FJHN | HNF-1B | HNF1 homeobox B | HNF1B | HNF2 | HPC11 | LF-B3 | LFB3 | HNF1beta | TCF2 | MODY5 | VHNF1 | HNF-1-beta | HNF1 beta A | Homeoprotein LFB3 | TCF-2 | Transcription factor 2
- UniProt Number
- P35680
- NCBI GenBank
- NM_000458 | NP_000449.1
- SwissProt
- P35680
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human HNF1B / HNF1 Beta
- Antigen Species
- Human
- Gene Name
- HNF1B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
