HMGN1 / HMG14 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general) |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749637-20
Catalog Number: LS-C749637
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HMG14 antibody LS-C749637 is an unconjugated rabbit polyclonal antibody to HMG14 (HMGN1) from human. It is reactive with human, mouse and rat. Validated for IHC.
- Application
- IHC
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HMG14 | HMGN1
- Recommended Dilution: IHC
- 1:50 - 1:200
- UniProt Number
- P05114
- NCBI GenBank
- NM_004965 | NP_004956.5
- SwissProt
- P05114
Target
- Target
- Human HMGN1 / HMG14
- Antigen Species
- Human
- Gene Name
- HMGN1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HMGN1 (NP_004956.5). MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS