Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
HMG4 antibody Western blot. All lanes: Anti HMG4 at 0.5 ug/ml. Lane 1: Mouse Liver Tissue Lysate at 50 ug. Lane 2: Mouse Kidney Tissue Lysate at 50 ug. Lane 3: Mouse Testis Tissue Lysate at 50 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Lane 5: MCF-7 Whole Cell Lysate at 40 ug. Lane 6: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 23 kD. Observed band size: 23 kD.
HMGB3 Antibody (aa62-95)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Chicken, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407845-100
Catalog Number: LS-C407845
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HMGB3 antibody LS-C407845 is an unconjugated rabbit polyclonal antibody to HMGB3 (aa62-95) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, Ck, GP, Ham, Hr, Hu, Mml, Ms, Rb, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HMGB3 | High mobility group protein 2a | High mobility group protein B3 | HMG-2a | High mobility group box 3 | High mobility group protein 4 | High-mobility group box 3 | HMG-4 | HMG2A | HMG4
- UniProt Number
- O15347
- NCBI GenBank
- NM_005342 | NP_005333.2
- SwissProt
- O15347
Target
- Target
- Human HMGB3
- Antigen Species
- Human
- Epitope
- Expressed predominantly in placenta.
- Gene Name
- HMGB3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human HMG4 (62-95 aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
