
Western blot testing of 1) rat brain, 2) mouse ovary, 3) human 22RV1 and 4) human HeLa lysate with HMGB1 antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa.
HMG1 / HMGB1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781952-100
Catalog Number: LS-C781952
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HMGB1 antibody LS-C781952 is an unconjugated rabbit polyclonal antibody to HMGB1 (HMG1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Amphoterin | High mobility group protein B1 | High mobility group box 1 | High mobility group protein 1 | HMG1 | HMG3 | SBP-1 | High-mobility group box 1 | HMG-1 | HMGB1
- UniProt Number
- P09429
- NCBI GenBank
- NM_002128 | NP_002119.1
- SwissProt
- P09429
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human HMG1 / HMGB1
- Antigen Species
- Human
- Gene Name
- HMGB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 124-154 (DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK) from the human protein were used as the immunogen for the HMGB1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
