Western blot - Anti-HMGB1/Hmg 1 Picoband Antibody
HMG1 / HMGB1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661914-100
Catalog Number: LS-C661914
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HMGB1 antibody LS-C661914 is an unconjugated rabbit polyclonal antibody to human HMGB1 (HMG1). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Amphoterin | High mobility group protein B1 | High mobility group box 1 | High mobility group protein 1 | HMG1 | HMG3 | SBP-1 | High-mobility group box 1 | HMG-1 | HMGB1
- UniProt Number
- P09429
- NCBI GenBank
- NM_002128 | NP_002119.1
- SwissProt
- P09429
Target
- Target
- Human HMG1 / HMGB1
- Antigen Species
- Human
- Epitope
- Ubiquituous. Expressed in platelets (PubMed:11154118). .
- Gene Name
- HMGB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human HMGB1 (124-154 aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl