
Western blot analysis of extracts of mouse liver cells.
HCRT / Orexin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C411347-20
Catalog Number: LS-C411347
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Orexin antibody LS-C411347 is an unconjugated rabbit polyclonal antibody to mouse Orexin (HCRT). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HCRT | PPORX | OX | Hypocretin | NRCLP1 | Orexin
- UniProt Number
- O43612
- NCBI GenBank
- NM_001524 | NP_001515.1
- SwissProt
- O43612
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human HCRT / Orexin
- Antigen Species
- Human
- Epitope
- Human HCRT / Orexin
- Gene Name
- HCRT
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 34-131 of human HCRT (NP_001515.1). QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAAASVAPGGQSGI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
