Western blot - Anti-HCN2 Picoband Antibody

HCN2 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C662167-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: HCN2 antibody LS-C662167 is an unconjugated rabbit polyclonal antibody to human HCN2. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: BCNG2 | BCNG-2 | HAC-1 | HCN2 | HAC1
UniProt Number: Q9UL51
NCBI GenBank: NM_001194 | NP_001185.3
SwissProt: Q9UL51

Target: Human HCN2
Antigen Species: Human
Epitope: Highly expressed throughout the brain. Detected at low levels in heart. .
Gene Name: HCN2

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human HCN2 (682-714 aa VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl