IHC testing of FFPE human liver cancer tissue with Hepatitis B Virus antibody at 0.5ug/ml. HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
HBV / Hepatitis B Virus Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Virus / Viral Antigen |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782761-100
Catalog Number: LS-C782761
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Hepatitis B Virus antibody LS-C782761 is an unconjugated rabbit polyclonal antibody to hepatitis b virus Hepatitis B Virus (HBV). Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Vir
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
Target
- Target
- Hepatitis B Virus HBV / Hepatitis B Virus
- Antigen Species
- Virus / Viral Antigen
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids 4-51 (WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ) from the human HBV Large S protein were used as the immunogen for the Hepatitis B Virus antibody.
- Immunogen Type
- Virus / Viral Particle
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS