Hepatitis B Virus was detected in paraffin-embedded sections of human liver cancer tissues using rabbit anti- Hepatitis B Virus Antigen Affinity purified polyclonal antibody
HBV / Hepatitis B Virus Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Virus / Viral Antigen |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662284-100
Catalog Number: LS-C662284
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Hepatitis B Virus antibody LS-C662284 is an unconjugated rabbit polyclonal antibody to hepatitis b virus Hepatitis B Virus (HBV). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Vir
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
Target
- Target
- Hepatitis B Virus HBV / Hepatitis B Virus
- Antigen Species
- Virus / Viral Antigen
- Epitope
- Antibody reacts with the large S protein.
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Hepatitis B Virus (4-51 aa WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl