
Western blot testing of 1) human SHG-44, 2) human ThP-1, 3) rat brain, 4) rat smooth muscle, 5) rat ovary, 6) mouse brain, 7) mouse smooth muscle, 8) mouse ovary, 9) mouse small intestine and 10) mouse Neuro-2a lysate with HAS1 antibody at 0.5ug/ml. Predicted molecular weight ~63 kDa.
HAS1 / HAS Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782264-100
Catalog Number: LS-C782264
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HAS antibody LS-C782264 is an unconjugated rabbit polyclonal antibody to HAS (HAS1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HAS1 | HAS | Hyaluronan synthase 1 | Hyaluronic acid synthase 1 | HuHAS1 | HA synthase 1 | Hyaluronate synthase 1
- UniProt Number
- Q92839
- NCBI GenBank
- NM_001523 | NP_001514.2
- SwissProt
- Q92839
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human HAS1 / HAS
- Antigen Species
- Human
- Gene Name
- HAS1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA were used as the immunogen for the HAS1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
