
Immunofluorescence analysis of U2OS cells using H2AFX antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
H2AFX / H2AX Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C746881-20
Catalog Number: LS-C746881
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- H2AX antibody LS-C746881 is an unconjugated rabbit polyclonal antibody to H2AX (H2AFX) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- H2AFX | H2AX | Histone H2A.x | H2A.X | H2A histone family, member X | H2AX histone
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P16104
- NCBI GenBank
- NM_002105 | NP_002096.1
- SwissProt
- P16104
Target
- Target
- Human H2AFX / H2AX
- Antigen Species
- Human
- Gene Name
- H2AX
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human H2AFX (NP_002096.1). VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
