Western blot analysis of extracts of various cell lines.

H1F0 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$293.00each

Catalog Number: LS-C332470-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: H1F0 antibody LS-C332470 is an unconjugated rabbit polyclonal antibody to H1F0 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: H1F0 | H1 histone family, member 0 | Histone H1(0) | H1.0, H1(0), H1-0 | H10 | H1FV | Histone H1 | Histone H1.0
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P07305
NCBI GenBank: NM_005318 | NP_005309.1
SwissProt: P07305

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human H1F0 (NP_005309.1). MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSV
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)