GSTA1/A2/A3/A4/A5 antibody Western blot. All lanes: Anti GSTA1/A2/A3/A4/A5 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Predicted band size: 26 kD. Observed band size: 26 kD.

GSTA1 Antibody (aa63-97)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Bovine, Dog, Guinea Pig, Hamster, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408160-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: GSTA1 antibody LS-C408160 is an unconjugated rabbit polyclonal antibody to GSTA1 (aa63-97) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
Application: WB
Reactivity: Bov, Can, GP, Ham, Hu, Mml, Ms, Por, Rb, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Gth1 | Glutathione s-transferase a1 | Gsta1-1 | Glutathione S-transferase 2 | GST class-alpha member 1 | GST HA subunit 1 | GST, class alpha, 1 | Gst-epsilon | GST2 | GSTA1
UniProt Number: P08263
NCBI GenBank: NM_145740 | NP_665683.1
SwissProt: P08263

Target

Target: Human GSTA1
Antigen Species: Human
Epitope: Expression not detected.
Gene Name: GSTA1

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human GSTA1/A2/A3/A4/A5 (63-97 aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl