Western blot - Anti-GSK3 alpha Picoband antibody
GSK3A / GSK3 Alpha Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662766-100
Catalog Number: LS-C662766
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GSK3 Alpha antibody LS-C662766 is an unconjugated rabbit polyclonal antibody to human GSK3 Alpha (GSK3A). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GSK3A | GSK-3 alpha | GSK3 alpha
- UniProt Number
- P49840
- NCBI GenBank
- NM_019884, NP_063937.2
- SwissProt
- P49840
Target
- Target
- Human GSK3A / GSK3 Alpha
- Antigen Species
- Hu
- Gene Name
- GSK3A
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human GSK3 alpha (QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR).
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl