Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
GRK5 antibody Western blot. All lanes: Anti GRK5 at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Lane 4: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.
GRK5 Antibody (aa393-429)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Human, Mammal (Other), Mouse, Pig |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407920-100
Catalog Number: LS-C407920
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GRK5 antibody LS-C407920 is an unconjugated rabbit polyclonal antibody to GRK5 (aa393-429) from human. It is reactive with human, mouse, bat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Hu, Mml, Ms, Por
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FP2025 | GPRK5 | GRK5
- UniProt Number
- P34947
- NCBI GenBank
- NM_005308 | NP_005299.1
- SwissProt
- P34947
Target
- Target
- Human GRK5
- Antigen Species
- Human
- Epitope
- Highest levels in heart, placenta, lung > skeletal muscle > brain, liver, pancreas > kidney. .
- Gene Name
- GRK5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human GRK5 (393-429 aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
