
Western blot testing of rat brain lysate with GRIN1 antibody at 0.5ug/ml. Predicted molecular weight ~105 kDa.
GRIN1 / NMDAR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782067-100
Catalog Number: LS-C782067
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NMDAR1 antibody LS-C782067 is an unconjugated rabbit polyclonal antibody to NMDAR1 (GRIN1) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GluN1 | GRIN1 | NMDAR1 | NR1 | MRD8 | NMD-R1 | NMDA receptor A1 | NMDA1 | NR1a | GluR zeta 1 | N-methyl-D aspartate receptor
- UniProt Number
- Q05586
- NCBI GenBank
- NM_007327 | NP_015566.1
- SwissProt
- Q05586
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human GRIN1 / NMDAR1
- Antigen Species
- Human
- Gene Name
- GRIN1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK from the human protein were used as the immunogen for the GRIN1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
