Western blot - Anti-NMDAR1 Picoband antibody
GRIN1 / NMDAR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662734-100
Catalog Number: LS-C662734
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NMDAR1 antibody LS-C662734 is an unconjugated rabbit polyclonal antibody to human NMDAR1 (GRIN1). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GluN1 | GRIN1 | NMDAR1 | NR1 | MRD8 | NMD-R1 | NMDA receptor A1 | NMDA1 | NR1a | GluR zeta 1 | N-methyl-D aspartate receptor
- UniProt Number
- Q05586
- NCBI GenBank
- NM_007327 | NP_015566.1
- SwissProt
- Q05586
Target
- Target
- Human GRIN1 / NMDAR1
- Antigen Species
- Human
- Gene Name
- GRIN1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human NMDAR1 (FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl