GRIK1 / GLUR5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C497183-20
Catalog Number: LS-C497183
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GLUR5 antibody LS-C497183 is an unconjugated rabbit polyclonal antibody to mouse GLUR5 (GRIK1). Validated for WB.
- Application
- WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GluR-5 | GLUR5 | EEA3 | GluK1 | GRIK1 | Glutamate receptor 5 | EAA3 | GLR5
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P39086
- NCBI GenBank
- NM_000830 | NP_000821.1
- SwissProt
- P39086
Target
- Target
- Human GRIK1 / GLUR5
- Antigen Species
- Human
- Gene Name
- GRIK1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 859-918 of human GRIK1 (NP_000821.1). YKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECGKLIREERGIRKQSSVHTV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS