Western blot analysis of extracts of mouse brain, using GREM2 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
GREM2 / Gremlin 2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749293-20
Catalog Number: LS-C749293
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Gremlin 2 antibody LS-C749293 is an unconjugated rabbit polyclonal antibody to Gremlin 2 (GREM2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CKTSF1B2 | DAN domain family member 3 | DAND3 | GREM2 | Gremlin-2 | Gremlin 2 | PRDC
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9H772
- NCBI GenBank
- NM_022469, NP_071914.3
- SwissProt
- Q9H772
Target
- Target
- Human GREM2 / Gremlin 2
- Antigen Species
- Hu
- Gene Name
- GREM2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human GREM2 (NP_071914.3). MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 3.73 mg/mL
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS