Western blot analysis of extracts of various cell lines, using GREM1 Antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 20s.
GREM1 / Gremlin-1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747019-20
Catalog Number: LS-C747019
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Gremlin-1 antibody LS-C747019 is an unconjugated rabbit polyclonal antibody to human Gremlin-1 (GREM1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CKTSF1B1 | DAN domain family member 2 | DAND2 | DRM | GREM1 | GREMLIN | Gremlin 1-like protein | Increased in high glucose-2 | Gremlin-1 | PIG2 | Proliferation-inducing gene 2 | Gremlin 1 | IHG-2
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O60565
- NCBI GenBank
- NM_013372 | NP_037504.1
- SwissProt
- O60565
Target
- Target
- Human GREM1 / Gremlin-1
- Antigen Species
- Human
- Gene Name
- GREM1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 44-143 of human GREM1 (NP_001178252.1). ERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS