Gremlin 1 antibody Western blot. All lanes: Anti Gremlin 1 at 0.5 ug/ml. WB: Rat Pancreas Tissue Lysate at 50 ug. Predicted band size: 23 kD. Observed band size: 23 kD.
GREM1 / Gremlin-1 Antibody (aa151-184)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Hamster, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407838-100
Catalog Number: LS-C407838
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Gremlin-1 antibody LS-C407838 is an unconjugated rabbit polyclonal antibody to Gremlin-1 (GREM1) (aa151-184) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Bov, Can, GP, Ham, Hu, Mml, Ms, Por, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CKTSF1B1 | DAN domain family member 2 | DAND2 | DRM | GREM1 | GREMLIN | Gremlin 1-like protein | Increased in high glucose-2 | Gremlin-1 | PIG2 | Proliferation-inducing gene 2 | Gremlin 1 | IHG-2
- UniProt Number
- O60565
- NCBI GenBank
- NM_013372 | NP_037504.1
- SwissProt
- O60565
Target
- Target
- Human GREM1 / Gremlin-1
- Antigen Species
- Human
- Epitope
- Highly expressed in small intestine, fetal brain and colon. Expression is restricted to intestinal subepithelial myofibroblasts (ISEMFs) at the crypt base. In subjects with HMPS1, by contrast, GREM1 is expressed, not only in basal ISEMFs, but also at very high levels in epithelial cells (predominantly colonocytes), with expression extending most of the way up the sides of the crypt. Weakly expressed in brain, ovary, prostate, pancreas and skeletal muscle. In brain found in the region localized around the internal capsule in the large subcortical nuclei, including caudate, putamen, substantia nigra, thalamus and subthalamus. Predominantly expressed in normal cells including neurons, astrocytes and fibroblasts. .
- Gene Name
- GREM1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Gremlin 1 (151-184 aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl