Western blot analysis of extract of various cells.
GPRC5A / RAI3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409709-20
Catalog Number: LS-C409709
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RAI3 antibody LS-C409709 is an unconjugated rabbit polyclonal antibody to RAI3 (GPRC5A) from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GPRC5A | RAIG-1 | Retinoic acid induced 3 | Retinoic acid responsive | GPCR5A | RAI3 | RAIG1 | Retinoic acid-inducible gene 1
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q8NFJ5
- NCBI GenBank
- NM_003979 | NP_003970.1
- SwissProt
- Q8NFJ5
Target
- Target
- Human GPRC5A / RAI3
- Antigen Species
- Human
- Epitope
- Human GPRC5A / RAI3
- Gene Name
- GPRC5A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 258-357 of human GPRC5A (NP_003970.1). LAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS