Western blot analysis of extracts of DU145 cells, using GPR87 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

GPR87 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C750132-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: GPR87 antibody LS-C750132 is an unconjugated rabbit polyclonal antibody to human GPR87. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: G protein-coupled receptor 95 | GPR87 | GPR95 | G protein-coupled receptor 87 | G-protein coupled receptor 95 | Orphan GPCR 87 | KPG_002 | FKSG78 | G-protein coupled receptor 87
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9BY21
NCBI GenBank: NM_023915 | NP_076404.3
SwissProt: Q9BY21

Target

Target: Human GPR87
Antigen Species: Human
Gene Name: GPR87

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GPR87 (NP_076404.3). HNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITLFLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVR
Immunogen Type: Synthetic Peptide (Linear)