Western blot analysis of extracts of various cell lines, using GPR55 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

GPR55 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C747960-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: GPR55 antibody LS-C747960 is an unconjugated rabbit polyclonal antibody to GPR55 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: G-protein coupled receptor 55 | G protein-coupled receptor 55 | GPR55
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9Y2T6
NCBI GenBank: NM_005683 | NP_005674.2
SwissProt: Q9Y2T6

Target

Target: Human GPR55
Antigen Species: Human
Gene Name: GPR55

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-319 of human GPR55 (NP_005674.2). GRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)