Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of 1) human placenta and 2) Jurkat lysate with GPI antibody at 0.5ug/ml. Predicted/observed molecular weight: ~63 kDa.
GPI Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781868-100
Catalog Number: LS-C781868
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GPI antibody LS-C781868 is an unconjugated rabbit polyclonal antibody to human GPI. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AMF | Autocrine motility factor | Glucose phosphate isomerase | Hexose monophosphate isomerase | Hexosephosphate isomerase | GPI | Neuroleukin | Oxoisomerase | Phosphoglucose isomerase | Phosphohexomutase | Phosphohexose isomerase | SA36 | PGI | SA-36 | Glucose-6-phosphate isomerase | GNPI | PHI | Phosphosaccharomutase | Sperm antigen 36 | Sperm antigen-36
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P06744
- NCBI GenBank
- NM_000175 | NP_000166.2
- SwissProt
- P06744
Target
- Target
- Human GPI
- Antigen Species
- Human
- Gene Name
- GPI
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 5-39 (TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH) from the human protein were used as the immunogen for the GPI antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
