Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
GNGT2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C498035-20
Catalog Number: LS-C498035
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GNGT2 antibody LS-C498035 is an unconjugated rabbit polyclonal antibody to mouse GNGT2. Validated for WB.
- Application
- WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- G-GAMMA-8 | G-gamma-9 | Gamma-T2 subunit | GNG9 | GNGT8 | G gamma-C | GNGT2 | G protein cone gamma 8 subunit | G-GAMMA-C
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O14610
- SwissProt
- O14610
Target
- Target
- Human GNGT2
- Antigen Species
- Human
- Gene Name
- GNGT2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human GNGT2 (NP_113686.1). MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
