Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot analysis of extracts of various cells.
GNG10 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409958-20
Catalog Number: LS-C409958
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GNG10 antibody LS-C409958 is an unconjugated rabbit polyclonal antibody to GNG10 from human. It is reactive with human, mouse and rat. Validated for WB. Cited in 1 publication.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GNG10 | GNGT10
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P50151
- SwissProt
- P50151
Target
- Target
- Human GNG10
- Antigen Species
- Human
- Epitope
- Human GNG10
- Gene Name
- GNG10
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG10 (NP_001017998.1). MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, 50% glycerol, pH 7.3
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
Knockdown of lncRNA CCAT1 Inhibits the Progression of Colorectal Cancer via hsa-miR-4679 Mediating the Downregulation of GNG10. Ning Wang, Jun Li, Ju He, Yong-Guang Jing, Wei-Dong Zhao, Wen-Jin Yu, Jing Wang. Journal of immunology research. 2022 January;2021:8930813. PubMed: 35005034 PMC: PMC8739552
